PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g017919m
Common NameCISIN_1g017919mg, LOC102611003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 365aa    MW: 38351.3 Da    PI: 9.0569
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g017919mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.2e-3975134362
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                        e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg+r+nk+s+
  orange1.1g017919m  75 EAALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKRSK 134
                        7789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2962123IPR003851Zinc finger, Dof-type
PfamPF027018.3E-3377132IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.60978132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MVFSSIPAYL DPANWQQQPN PQTGASTGVS TQFVQPQAPP PPPPQPHGSG GGGAGSIRPG  60
SMADRARMAN VPMPEAALKC PRCESTNTKF CYFNNYSLSQ PRHFCKTCRR YWTRGGALRN  120
VPVGGGCRRN KRSKGGSSGS SKSPVNSTDR QTASGNNSTS TMSCNNSGGA SDILGLGPQI  180
PQLRFMTPNL HHFTSEFPSG DIGLNYGSLT APPVANELNF GGSLLSSLSG LDQWRLQQQA  240
HHHQQFPFLG GLDSSSSSPS GLYPFEGGVE ASGYGVGGSA GQIRPKISST GIVSQLAAAA  300
APVKMEESSH HHHQQQQEIN LSRQFLGMQG NEHQYWSSTT AAGAAAAGWT DLSSFSSSST  360
SNPL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.168962e-62stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006480798.10.0PREDICTED: dof zinc finger protein DOF2.4
TrEMBLA0A067DW430.0A0A067DW43_CITSI; Uncharacterized protein
STRINGPOPTR_0006s08440.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17132886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.15e-42DNA binding with one finger 2.4